Brand: | Abnova |
Reference: | H00004780-M02 |
Product name: | NFE2L2 monoclonal antibody (M02), clone 2G7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NFE2L2. |
Clone: | 2G7 |
Isotype: | IgG2a Kappa |
Gene id: | 4780 |
Gene name: | NFE2L2 |
Gene alias: | NRF2 |
Gene description: | nuclear factor (erythroid-derived 2)-like 2 |
Genbank accession: | BC011558 |
Immunogen: | NFE2L2 (AAH11558, 71 a.a. ~ 170 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | FAQLQLDEETGEFLPIQPAQHIQSETSGSANYSQVAHIPKSDALYFDDCMQLLAQTFPFVDDNEVSSATFQSLVPDIPGHIESPVFIATNQAQSPETSVA |
Protein accession: | AAH11558 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged NFE2L2 is approximately 3ng/ml as a capture antibody. |
Applications: | IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |