NEUROD1 monoclonal antibody (M01), clone 3H8 View larger

NEUROD1 monoclonal antibody (M01), clone 3H8

H00004760-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NEUROD1 monoclonal antibody (M01), clone 3H8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about NEUROD1 monoclonal antibody (M01), clone 3H8

Brand: Abnova
Reference: H00004760-M01
Product name: NEUROD1 monoclonal antibody (M01), clone 3H8
Product description: Mouse monoclonal antibody raised against a partial recombinant NEUROD1.
Clone: 3H8
Isotype: IgG2a Kappa
Gene id: 4760
Gene name: NEUROD1
Gene alias: BETA2|BHF-1|NEUROD|bHLHa3
Gene description: neurogenic differentiation 1
Genbank accession: BC009046
Immunogen: NEUROD1 (AAH09046, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QDMPPHLPTASASFPVHPYSYQSPGLPSPPYGTMDSSHVFHVKPPPHAYSAALEPFFESPLTDCTSPSFDGPLSPPLSINGNFSFKHEPSAEFEKNYAFT
Protein accession: AAH09046
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004760-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004760-M01-3-15-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to NEUROD1 on formalin-fixed paraffin-embedded human ovary, clear cell carcinoma. [antibody concentration 3 ug/ml]
Applications: IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice
Publications: Neuroendocrine carcinoma of the esophagus: clinicopathologic study of 10 cases and verification of the diagnostic utility of mASH1, NeuroD1, and PGP9.5.Akazawa M, Kawachi H, Kitagaki K, Seki T, Kawaragi S, Yuzawa M, Sekine M, Kobayashi M, Nakajima Y, Kawano T, Eishi Y.
Esophagus DOI 10.1007/s10388-014-0444-6

Reviews

Buy NEUROD1 monoclonal antibody (M01), clone 3H8 now

Add to cart