Brand: | Abnova |
Reference: | H00004759-M04 |
Product name: | NEU2 monoclonal antibody (M04), clone 2E5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NEU2. |
Clone: | 2E5 |
Isotype: | IgG2a Lambda |
Gene id: | 4759 |
Gene name: | NEU2 |
Gene alias: | MGC129579|SIAL2 |
Gene description: | sialidase 2 (cytosolic sialidase) |
Genbank accession: | NM_005383 |
Immunogen: | NEU2 (NP_005374, 180 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPP |
Protein accession: | NP_005374 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged NEU2 is approximately 3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |