Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NEU2 monoclonal antibody (M03), clone 3B9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,S-ELISA,ELISA,WB-Re |
More info about NEU2 monoclonal antibody (M03), clone 3B9
| Brand: | Abnova |
| Reference: | H00004759-M03 |
| Product name: | NEU2 monoclonal antibody (M03), clone 3B9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NEU2. |
| Clone: | 3B9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4759 |
| Gene name: | NEU2 |
| Gene alias: | MGC129579|SIAL2 |
| Gene description: | sialidase 2 (cytosolic sialidase) |
| Genbank accession: | NM_005383 |
| Immunogen: | NEU2 (NP_005374, 180 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPP |
| Protein accession: | NP_005374 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | NEU2 monoclonal antibody (M03), clone 3B9. Western Blot analysis of NEU2 expression in human liver. |
| Applications: | WB-Ti,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Macrophages discriminate glycosylation patterns of apoptotic cell-derived microparticles.Bilyy RO, Shkandina T, Tomin A, Munoz LE, Franz S, Antonyuk V, Kit YY, Zirngibl M, Fuernrohr BG, Janko C, Lauber K, Schiller M, Schett G, Stoika RS, Herrmann M. J Biol Chem. 2011 Nov 10. |