NEU2 monoclonal antibody (M02), clone 3G9 View larger

NEU2 monoclonal antibody (M02), clone 3G9

H00004759-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NEU2 monoclonal antibody (M02), clone 3G9

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about NEU2 monoclonal antibody (M02), clone 3G9

Brand: Abnova
Reference: H00004759-M02
Product name: NEU2 monoclonal antibody (M02), clone 3G9
Product description: Mouse monoclonal antibody raised against a partial recombinant NEU2.
Clone: 3G9
Isotype: IgG2a Lambda
Gene id: 4759
Gene name: NEU2
Gene alias: MGC129579|SIAL2
Gene description: sialidase 2 (cytosolic sialidase)
Genbank accession: NM_005383
Immunogen: NEU2 (NP_005374, 180 a.a. ~ 268 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: AYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPP
Protein accession: NP_005374
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004759-M02-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged NEU2 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy NEU2 monoclonal antibody (M02), clone 3G9 now

Add to cart