Brand: | Abnova |
Reference: | H00004758-M01 |
Product name: | NEU1 monoclonal antibody (M01), clone 3F9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NEU1. |
Clone: | 3F9 |
Isotype: | IgG2a Kappa |
Gene id: | 4758 |
Gene name: | NEU1 |
Gene alias: | FLJ93471|NANH|NEU|SIAL1 |
Gene description: | sialidase 1 (lysosomal sialidase) |
Genbank accession: | NM_000434 |
Immunogen: | NEU1 (NP_000425, 334 a.a. ~ 415 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL |
Protein accession: | NP_000425 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (34.76 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged NEU1 is 0.03 ng/ml as a capture antibody. |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |