NEU1 polyclonal antibody (A01) View larger

NEU1 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NEU1 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about NEU1 polyclonal antibody (A01)

Brand: Abnova
Reference: H00004758-A01
Product name: NEU1 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant NEU1.
Gene id: 4758
Gene name: NEU1
Gene alias: FLJ93471|NANH|NEU|SIAL1
Gene description: sialidase 1 (lysosomal sialidase)
Genbank accession: NM_000434
Immunogen: NEU1 (NP_000425, 334 a.a. ~ 415 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: NPAHPEFRVNLTLRWSFSNGTSWRKETVQLWPGPSGYSSLATLEGSMDGEEQAPQLYVLYEKGRNHYTESISVAKISVYGTL
Protein accession: NP_000425
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004758-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.13 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NEU1 polyclonal antibody (A01) now

Add to cart