NEK2 monoclonal antibody (M03), clone 2A10 View larger

NEK2 monoclonal antibody (M03), clone 2A10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NEK2 monoclonal antibody (M03), clone 2A10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about NEK2 monoclonal antibody (M03), clone 2A10

Brand: Abnova
Reference: H00004751-M03
Product name: NEK2 monoclonal antibody (M03), clone 2A10
Product description: Mouse monoclonal antibody raised against a partial recombinant NEK2.
Clone: 2A10
Isotype: IgG2a Kappa
Gene id: 4751
Gene name: NEK2
Gene alias: HsPK21|NEK2A|NLK1
Gene description: NIMA (never in mitosis gene a)-related kinase 2
Genbank accession: BC043502
Immunogen: NEK2 (AAH43502, 331 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EQELCVRERLAEDKLARAENLLKNYSLLKERKFLSLASNPELLNLPSSVIKKKVHFSGESKENIMRSENSESQLTSKSKCKDLKKRLHAAQLRAQALSDIEKNYQLKSRQILGMR
Protein accession: AAH43502
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004751-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.28 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004751-M03-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged NEK2 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NEK2 monoclonal antibody (M03), clone 2A10 now

Add to cart