Brand: | Abnova |
Reference: | H00004751-M01 |
Product name: | NEK2 monoclonal antibody (M01), clone 2F6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NEK2. |
Clone: | 2F6 |
Isotype: | IgG2a Kappa |
Gene id: | 4751 |
Gene name: | NEK2 |
Gene alias: | HsPK21|NEK2A|NLK1 |
Gene description: | NIMA (never in mitosis gene a)-related kinase 2 |
Genbank accession: | BC043502 |
Immunogen: | NEK2 (AAH43502, 331 a.a. ~ 445 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EQELCVRERLAEDKLARAENLLKNYSLLKERKFLSLASNPELLNLPSSVIKKKVHFSGESKENIMRSENSESQLTSKSKCKDLKKRLHAAQLRAQALSDIEKNYQLKSRQILGMR |
Protein accession: | AAH43502 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.28 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to NEK2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |