Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NELL1 monoclonal antibody (M01), clone 6A8
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
More info about NELL1 monoclonal antibody (M01), clone 6A8
| Brand: | Abnova |
| Reference: | H00004745-M01 |
| Product name: | NELL1 monoclonal antibody (M01), clone 6A8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NELL1. |
| Clone: | 6A8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4745 |
| Gene name: | NELL1 |
| Gene alias: | FLJ45906|IDH3GL|NRP1 |
| Gene description: | NEL-like 1 (chicken) |
| Genbank accession: | NM_006157 |
| Immunogen: | NELL1 (NP_006148, 304 a.a. ~ 403 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | CRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGVLVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGE |
| Protein accession: | NP_006148 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of NELL1 expression in transfected 293T cell line by NELL1 monoclonal antibody (M01), clone 6A8. Lane 1: NELL1 transfected lysate(89.607 KDa). Lane 2: Non-transfected lysate. |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |
| Publications: | Systematic association mapping identifies NELL1 as a novel IBD disease gene.Franke A, Hampe J, Rosenstiel P, Becker C, Wagner F, Hasler R, Little RD, Huse K, Ruether A, Balschun T, Wittig M, Elsharawy A, Mayr G, Albrecht M, Prescott NJ, Onnie CM, Fournier H, Keith T, Radelof U, Platzer M, Mathew CG, Stoll M, Krawczak M, Nurnberg PLoS ONE. 2007 Aug 8;2(1):e691. |