H00004739-M01A_200uL
New product
Availability date:
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00004739-M01A |
Product name: | NEDD9 monoclonal antibody (M01A), clone 1B4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NEDD9. |
Clone: | 1B4 |
Isotype: | IgG1 Kappa |
Gene id: | 4739 |
Gene name: | NEDD9 |
Gene alias: | CAS-L|CAS2|CASL|CASS2|HEF1|dJ49G10.2|dJ761I2.1 |
Gene description: | neural precursor cell expressed, developmentally down-regulated 9 |
Genbank accession: | NM_006403 |
Immunogen: | NEDD9 (NP_006394, 101 a.a. ~ 200 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PRDTIYQVPPSYQNQGIYQVPTGHGTQEQEVYQVPPSVQRSIGGTSGPHVGKKVITPVRTGHGYVYEYPSRYQKDVYDIPPSHTTQGVYDIPPSSAKGPV |
Protein accession: | NP_006394 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of NEDD9 expression in transfected 293T cell line by NEDD9 monoclonal antibody (M01A), clone 1B4. Lane 1: NEDD9 transfected lysate(92.9 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |