Brand: | Abnova |
Reference: | H00004729-M03 |
Product name: | NDUFV2 monoclonal antibody (M03), clone 1A10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NDUFV2. |
Clone: | 1A10 |
Isotype: | IgG2a Kappa |
Gene id: | 4729 |
Gene name: | NDUFV2 |
Gene alias: | - |
Gene description: | NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa |
Genbank accession: | NM_021074 |
Immunogen: | NDUFV2 (NP_066552, 150 a.a. ~ 249 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | EAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL |
Protein accession: | NP_066552 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | NDUFV2 monoclonal antibody (M03), clone 1A10. Western Blot analysis of NDUFV2 expression in K-562(Cat # L009V1 ). |
Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |