NDUFV2 purified MaxPab mouse polyclonal antibody (B01P) View larger

NDUFV2 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NDUFV2 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about NDUFV2 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00004729-B01P
Product name: NDUFV2 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human NDUFV2 protein.
Gene id: 4729
Gene name: NDUFV2
Gene alias: -
Gene description: NADH dehydrogenase (ubiquinone) flavoprotein 2, 24kDa
Genbank accession: NM_021074
Immunogen: NDUFV2 (NP_066552.1, 1 a.a. ~ 249 a.a) full-length human protein.
Immunogen sequence/protein sequence: MFFSAALRARAAGLTAHWGRHVRNLHKTAMQNGAGGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL
Protein accession: NP_066552.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004729-B01P-2-A1-1.jpg
Application image note: NDUFV2 MaxPab polyclonal antibody. Western Blot analysis of NDUFV2 expression in human liver.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NDUFV2 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart