Cart 51 Product Products 18 275,68 € (empty)
No products
To be determined Shipping
18 275,68 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 51 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 18 275,68 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 18 275,68 €
Data sheet of NDUFS5 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ti,WB-Tr |
More info about NDUFS5 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00004725-D01P |
| Product name: | NDUFS5 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human NDUFS5 protein. |
| Gene id: | 4725 |
| Gene name: | NDUFS5 |
| Gene alias: | - |
| Gene description: | NADH dehydrogenase (ubiquinone) Fe-S protein 5, 15kDa (NADH-coenzyme Q reductase) |
| Genbank accession: | NM_004552.1 |
| Immunogen: | NDUFS5 (NP_004543.1, 1 a.a. ~ 106 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MPFLDIQKRFGLNIDRWLTIQSGEQPYKMAGRCHAFEKEWIECAHGIGYTRAEKECKIEYDDFVECLLRQKTMRRAGTIRKQRDKLIKEGKYTPPPHHIGKGEPRP |
| Protein accession: | NP_004543.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of NDUFS5 expression in transfected 293T cell line (H00004725-T02) by NDUFS5 MaxPab polyclonal antibody. Lane 1: NDUFS5 transfected lysate(12.50 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |