Brand: | Abnova |
Reference: | H00004724-M03 |
Product name: | NDUFS4 monoclonal antibody (M03), clone 3F11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NDUFS4. |
Clone: | 3F11 |
Isotype: | IgG2a Kappa |
Gene id: | 4724 |
Gene name: | NDUFS4 |
Gene alias: | AQDQ |
Gene description: | NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase) |
Genbank accession: | NM_002495 |
Immunogen: | NDUFS4 (NP_002486, 66 a.a. ~ 175 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK |
Protein accession: | NP_002486 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | NDUFS4 monoclonal antibody (M03), clone 3F11. Western Blot analysis of NDUFS4 expression in human kidney. |
Applications: | WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |