NDUFS4 monoclonal antibody (M01A), clone 1A1 View larger

NDUFS4 monoclonal antibody (M01A), clone 1A1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NDUFS4 monoclonal antibody (M01A), clone 1A1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re,WB-Tr

More info about NDUFS4 monoclonal antibody (M01A), clone 1A1

Brand: Abnova
Reference: H00004724-M01A
Product name: NDUFS4 monoclonal antibody (M01A), clone 1A1
Product description: Mouse monoclonal antibody raised against a partial recombinant NDUFS4.
Clone: 1A1
Isotype: IgG2a Kappa
Gene id: 4724
Gene name: NDUFS4
Gene alias: AQDQ
Gene description: NADH dehydrogenase (ubiquinone) Fe-S protein 4, 18kDa (NADH-coenzyme Q reductase)
Genbank accession: NM_002495
Immunogen: NDUFS4 (NP_002486, 66 a.a. ~ 175 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GVPEEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADPLSNMVLTFSTKEDAVSFAEKNGWSYDIEERKVPKPKSKSYGANFSWNKRTRVSTK
Protein accession: NP_002486
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004724-M01A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004724-M01A-1-4-1.jpg
Application image note: NDUFS4 monoclonal antibody (M01A), clone 1A1 Western Blot analysis of NDUFS4 expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy NDUFS4 monoclonal antibody (M01A), clone 1A1 now

Add to cart