Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NDUFV1 monoclonal antibody (M01), clone 4A7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about NDUFV1 monoclonal antibody (M01), clone 4A7
| Brand: | Abnova |
| Reference: | H00004723-M01 |
| Product name: | NDUFV1 monoclonal antibody (M01), clone 4A7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NDUFV1. |
| Clone: | 4A7 |
| Isotype: | IgG2b Kappa |
| Gene id: | 4723 |
| Gene name: | NDUFV1 |
| Gene alias: | CI-51kD|UQOR1 |
| Gene description: | NADH dehydrogenase (ubiquinone) flavoprotein 1, 51kDa |
| Genbank accession: | NM_007103 |
| Immunogen: | NDUFV1 (NP_002466, 365 a.a. ~ 464 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVRGDARPAEIDSLWEISKQIEGHTICALGDGAAWPVQGLIRHFRPELEERMQRFAQQHQARQAAS |
| Protein accession: | NP_002466 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | Western blot analysis of NDUFV1 over-expressed 293 cell line, cotransfected with NDUFV1 Validated Chimera RNAi ( Cat # H00004723-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with NDUFV1 monoclonal antibody (M01), clone 4A7 (Cat # H00004723-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Human Ind1, an iron-sulfur cluster assembly factor for respiratory complex I.Sheftel AD, Stehling O, Pierik AJ, Netz DJ, Kerscher S, Elsasser HP, Wittig I, Balk J, Brandt U, Lill R. Mol Cell Biol. 2009 Sep 14. [Epub ahead of print] |