Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00004711-M01 |
Product name: | NDUFB5 monoclonal antibody (M01), clone 5G5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NDUFB5. |
Clone: | 5G5 |
Isotype: | IgG1 Kappa |
Gene id: | 4711 |
Gene name: | NDUFB5 |
Gene alias: | CI-SGDH|DKFZp686N02262|FLJ30597|MGC111204|MGC12314|SGDH |
Gene description: | NADH dehydrogenase (ubiquinone) 1 beta subcomplex, 5, 16kDa |
Genbank accession: | NM_002492 |
Immunogen: | NDUFB5 (NP_002483, 95 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QAELAEIPEGYVPEHWEYYKHPISRWIARNFYDSPEKIYERTMAVLQIEAEKAELRVKELEVRKLMHVRGDGPWYYYETIDKELIDHSPKATPDN |
Protein accession: | NP_002483 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.19 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of NDUFB5 expression in transfected 293T cell line by NDUFB5 monoclonal antibody (M01), clone 5G5. Lane 1: NDUFB5 transfected lysate(21.8 KDa). Lane 2: Non-transfected lysate. |
Applications: | ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |