Brand: | Abnova |
Reference: | H00004695-M01 |
Product name: | NDUFA2 monoclonal antibody (M01), clone 6E7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NDUFA2. |
Clone: | 6E7 |
Isotype: | IgG1 Kappa |
Gene id: | 4695 |
Gene name: | NDUFA2 |
Gene alias: | B8|CD14 |
Gene description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 2, 8kDa |
Genbank accession: | NM_002488 |
Immunogen: | NDUFA2 (NP_002479, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAAAAASRGVGAKLGLREIRIHLCQRSPGSQGVRDFIEKRYVELKKANPDLPILIRECSDVQPKLWARYAFGQETNVPLNNFSADQVTRALENVLSGKA |
Protein accession: | NP_002479 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |