Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NDUFA1 monoclonal antibody (M10), clone 2A4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about NDUFA1 monoclonal antibody (M10), clone 2A4
| Brand: | Abnova |
| Reference: | H00004694-M10 |
| Product name: | NDUFA1 monoclonal antibody (M10), clone 2A4 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant NDUFA1. |
| Clone: | 2A4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4694 |
| Gene name: | NDUFA1 |
| Gene alias: | CI-MWFE|MWFE|ZNF183 |
| Gene description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 1, 7.5kDa |
| Genbank accession: | BC000266 |
| Immunogen: | NDUFA1 (AAH00266, 1 a.a. ~ 70 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MWFEILPGLSVMGVCLLIPGLATAYIHRFTNGGKEKRVAHFGYHWSLMERDRRISGVDRYYVSKGLENID |
| Protein accession: | AAH00266 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |