Brand: | Abnova |
Reference: | H00004692-M07 |
Product name: | NDN monoclonal antibody (M07), clone 2D11 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NDN. |
Clone: | 2D11 |
Isotype: | IgG2a Kappa |
Gene id: | 4692 |
Gene name: | NDN |
Gene alias: | HsT16328|PWCR |
Gene description: | necdin homolog (mouse) |
Genbank accession: | NM_002487 |
Immunogen: | NDN (NP_002478, 222 a.a. ~ 321 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | WKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLARVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSED |
Protein accession: | NP_002478 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00004692-M07-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00004692-M07-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00004692-M07-1-23-1.jpg](http://www.abnova.com/application_image/H00004692-M07-1-23-1.jpg) |
Application image note: | NDN monoclonal antibody (M07), clone 2D11 Western Blot analysis of NDN expression in U-2 OS ( Cat # L022V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |