NDN monoclonal antibody (M06), clone 3C1 View larger

NDN monoclonal antibody (M06), clone 3C1

H00004692-M06_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NDN monoclonal antibody (M06), clone 3C1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr,IP

More info about NDN monoclonal antibody (M06), clone 3C1

Brand: Abnova
Reference: H00004692-M06
Product name: NDN monoclonal antibody (M06), clone 3C1
Product description: Mouse monoclonal antibody raised against a partial recombinant NDN.
Clone: 3C1
Isotype: IgG2a Kappa
Gene id: 4692
Gene name: NDN
Gene alias: HsT16328|PWCR
Gene description: necdin homolog (mouse)
Genbank accession: NM_002487
Immunogen: NDN (NP_002478, 222 a.a. ~ 321 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: WKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLARVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSED
Protein accession: NP_002478
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004692-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004692-M06-13-15-1.jpg
Application image note: Western Blot analysis of NDN expression in transfected 293T cell line by NDN monoclonal antibody (M06), clone 3C1.

Lane 1: NDN transfected lysate(36.1 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy NDN monoclonal antibody (M06), clone 3C1 now

Add to cart