NDN monoclonal antibody (M02), clone 1B3 View larger

NDN monoclonal antibody (M02), clone 1B3

H00004692-M02_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NDN monoclonal antibody (M02), clone 1B3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about NDN monoclonal antibody (M02), clone 1B3

Brand: Abnova
Reference: H00004692-M02
Product name: NDN monoclonal antibody (M02), clone 1B3
Product description: Mouse monoclonal antibody raised against a partial recombinant NDN.
Clone: 1B3
Isotype: IgG2a Kappa
Gene id: 4692
Gene name: NDN
Gene alias: HsT16328|PWCR
Gene description: necdin homolog (mouse)
Genbank accession: NM_002487
Immunogen: NDN (NP_002478, 222 a.a. ~ 321 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: WKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLARVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSED
Protein accession: NP_002478
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004692-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004692-M02-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to NDN on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice
Publications: Necdin Enhances Myoblasts Survival by Facilitating the Degradation of the Mediator of Apoptosis CCAR1/CARP1.Francois S, D'Orlando C, Fatone T, Touvier T, Pessina P, Meneveri R, Brunelli S.
PLoS One. 2012;7(8):e43335. Epub 2012 Aug 14.

Reviews

Buy NDN monoclonal antibody (M02), clone 1B3 now

Add to cart