Brand: | Abnova |
Reference: | H00004690-M01 |
Product name: | NCK1 monoclonal antibody (M01), clone 1A1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NCK1. |
Clone: | 1A1 |
Isotype: | IgG1 Kappa |
Gene id: | 4690 |
Gene name: | NCK1 |
Gene alias: | MGC12668|NCK|NCKalpha |
Gene description: | NCK adaptor protein 1 |
Genbank accession: | BC006403 |
Immunogen: | NCK1 (AAH06403, 185 a.a. ~ 294 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | NLNTGQVLHVVQALYPFSSSNDEELNFEKGDVMDVIEKPENDPEWWKCRKINGMVGLVPKNYVTVMQNNPLTSGLEPSPPQCDYIRPSLTGKFAGNPWYYGKVTRHQAEM |
Protein accession: | AAH06403 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00004690-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00004690-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00004690-M01-1-25-1.jpg](http://www.abnova.com/application_image/H00004690-M01-1-25-1.jpg) |
Application image note: | NCK1 monoclonal antibody (M01), clone 1A1 Western Blot analysis of NCK1 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |