Brand: | Abnova |
Reference: | H00004689-M01 |
Product name: | NCF4 monoclonal antibody (M01), clone 3C10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NCF4. |
Clone: | 3C10 |
Isotype: | IgG2a Kappa |
Gene id: | 4689 |
Gene name: | NCF4 |
Gene alias: | MGC3810|NCF|P40PHOX|SH3PXD4 |
Gene description: | neutrophil cytosolic factor 4, 40kDa |
Genbank accession: | BC002798 |
Immunogen: | NCF4 (AAH02798, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MAVAQQLRAESDFEQLPDDVAISANIADIEEKRGFTSHFVFVIEVKTKGGSKYLIYRRYRQFHALQSKLEERFGPDSKSSALACTLPTLPAKVYVGVKQE |
Protein accession: | AAH02798 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00004689-M01-9-20-1.jpg](http://www.abnova.com/application_image/H00004689-M01-9-20-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged NCF4 is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |