Brand: | Abnova |
Reference: | H00004686-M04 |
Product name: | NCBP1 monoclonal antibody (M04), clone 1E9 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant NCBP1. |
Clone: | 1E9 |
Isotype: | IgG2b Kappa |
Gene id: | 4686 |
Gene name: | NCBP1 |
Gene alias: | CBP80|MGC2087|NCBP |
Gene description: | nuclear cap binding protein subunit 1, 80kDa |
Genbank accession: | NM_002486 |
Immunogen: | NCBP1 (NP_002477, 2 a.a. ~ 99 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYN |
Protein accession: | NP_002477 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00004686-M04-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00004686-M04-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | http://www.abnova.com/application_image/ |
Application image note: | Detection limit for recombinant GST tagged NCBP1 is approximately 30ng/ml as a capture antibody. |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |