MYOG monoclonal antibody (M01), clone 2B7 View larger

MYOG monoclonal antibody (M01), clone 2B7

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MYOG monoclonal antibody (M01), clone 2B7

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about MYOG monoclonal antibody (M01), clone 2B7

Brand: Abnova
Reference: H00004656-M01
Product name: MYOG monoclonal antibody (M01), clone 2B7
Product description: Mouse monoclonal antibody raised against a full length recombinant MYOG.
Clone: 2B7
Isotype: IgG1 kappa
Gene id: 4656
Gene name: MYOG
Gene alias: MYF4|MYOGENIN|bHLHc3
Gene description: myogenin (myogenic factor 4)
Genbank accession: BC053899
Immunogen: MYOG (AAH53899, 1 a.a. ~ 224 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MELYETSPYFYQEPRFYDGENYLPVHLQGFEPPGYERTELTLSPEAPGPLEDKGLGTPEHCPGQCLPWACKVCKRKSVSVDRRRAATLREKRRLKKVNEAFEALKRSTLLNPNQRLPKVEILRSAIQYIERLQALLSSLNQEERDLRYRGGGGPQPGVPSECSSHSASCSPEWGSALEFSANPGDHLLTADPTDAHNLHSLTSIVDSITVEDVSVAFPDETMPN
Protein accession: AAH53899
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004656-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (50.38 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004656-M01-42-R01V-1.jpg
Application image note: Western blot analysis of MYOG over-expressed 293 cell line, cotransfected with MYOG Validated Chimera RNAi ( Cat # H00004656-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MYOG monoclonal antibody (M01), clone 2B7 (Cat # H00004656-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy MYOG monoclonal antibody (M01), clone 2B7 now

Add to cart