Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MYO5A (Human) Recombinant Protein (Q01)
| Brand | Abnova |
| Product type | Proteins |
| Host species | Wheat Germ (in vitro) |
| Applications | AP,Array,ELISA,WB-Re |
More info about MYO5A (Human) Recombinant Protein (Q01)
| Brand: | Abnova |
| Reference: | H00004644-Q01 |
| Product name: | MYO5A (Human) Recombinant Protein (Q01) |
| Product description: | Human MYO5A partial ORF ( NP_000250.1, 1758 a.a. - 1853 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 4644 |
| Gene name: | MYO5A |
| Gene alias: | GS1|MYH12|MYO5|MYR12 |
| Gene description: | myosin VA (heavy chain 12, myoxin) |
| Genbank accession: | NM_000259 |
| Immunogen sequence/protein sequence: | KKTDDDAEAICSMCNALTTAQIVKVLNLYTPVNEFEERVSVSFIRTIQMRLRDRKDSPQLLMDAKHIFPVTFPFNPSSLALETIQIPASLGLGFIS |
| Protein accession: | NP_000250.1 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Quality control testing picture: |  |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Product type: | Proteins |
| Host species: | Wheat Germ (in vitro) |
| Antigen species / target species: | Human |
| Applications: | AP,Array,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Myosin 5a regulates tumor migration and epithelial-mesenchymal transition in esophageal squamous cell carcinoma: utility as a prognostic factor.Sato N, Fujishima F, Nakamura Y, Aoyama Y, Onodera Y, Ozawa Y, Ito K, Ishida H, Kamei T, Watanabe M, Sasano H. Hum Pathol. 2018 Jun 10. [Epub ahead of print] |