MYLK monoclonal antibody (M01), clone 1D1 View larger

MYLK monoclonal antibody (M01), clone 1D1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MYLK monoclonal antibody (M01), clone 1D1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re,WB-Tr

More info about MYLK monoclonal antibody (M01), clone 1D1

Brand: Abnova
Reference: H00004638-M01
Product name: MYLK monoclonal antibody (M01), clone 1D1
Product description: Mouse monoclonal antibody raised against a partial recombinant MYLK.
Clone: 1D1
Isotype: IgG1 Kappa
Gene id: 4638
Gene name: MYLK
Gene alias: DKFZp686I10125|FLJ12216|KRP|MLCK|MLCK1|MLCK108|MLCK210|MSTP083|MYLK1|smMLCK
Gene description: myosin light chain kinase
Genbank accession: NM_053025
Immunogen: MYLK (NP_444253, 1710 a.a. ~ 1809 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CTQCLQHPWLMKDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSMAMISGLSGRKSSTGSPTSPLNAEKLESEEDVSQAFLEAVAEEKPHVKP
Protein accession: NP_444253
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004638-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004638-M01-13-15-1.jpg
Application image note: Western Blot analysis of MYLK expression in transfected 293T cell line by MYLK monoclonal antibody (M01), clone 1D1.

Lane 1: MYLK transfected lysate(110.2 KDa).
Lane 2: Non-transfected lysate.
Applications: ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MYLK monoclonal antibody (M01), clone 1D1 now

Add to cart