MYL4 MaxPab mouse polyclonal antibody (B01) View larger

MYL4 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MYL4 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about MYL4 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00004635-B01
Product name: MYL4 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human MYL4 protein.
Gene id: 4635
Gene name: MYL4
Gene alias: ALC1|AMLC|GT1|PRO1957
Gene description: myosin, light chain 4, alkali; atrial, embryonic
Genbank accession: NM_001002841.1
Immunogen: MYL4 (NP_001002841.1, 1 a.a. ~ 197 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTADQIEEFKEAFSLFDRTPTGEMKITYGQCGDVLRALGQNPTNAEVLRVLGKPKPEEMNVKMLDFETFLPILQHISRNKEQGTYEDFVEGLRVFDKESNGTVMGAELRHVLATLGEKMTEAEVEQLLAGQEDANGCINYEAFVKHIMSG
Protein accession: NP_001002841.1
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004635-B01-13-15-1.jpg
Application image note: Western Blot analysis of MYL4 expression in transfected 293T cell line (H00004635-T01) by MYL4 MaxPab polyclonal antibody.

Lane 1: MYL4 transfected lysate(21.67 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MYL4 MaxPab mouse polyclonal antibody (B01) now

Add to cart