MYCN polyclonal antibody (A01) View larger

MYCN polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MYCN polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about MYCN polyclonal antibody (A01)

Brand: Abnova
Reference: H00004613-A01
Product name: MYCN polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant MYCN.
Gene id: 4613
Gene name: MYCN
Gene alias: MODED|N-myc|NMYC|ODED|bHLHe37
Gene description: v-myc myelocytomatosis viral related oncogene, neuroblastoma derived (avian)
Genbank accession: NM_005378
Immunogen: MYCN (NP_005369, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: MPSCSTSTMPGMICKNPDLEFDSLQPCFYPDEDDFYFGGPDSTPPGEDIWKKFELLPTPPLSPSRGFAEHSSEPPSWVTEMLLENELWGSPAEEDAFGLG
Protein accession: NP_005369
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004613-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MYCN polyclonal antibody (A01) now

Add to cart