MVK polyclonal antibody (A01) View larger

MVK polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MVK polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about MVK polyclonal antibody (A01)

Brand: Abnova
Reference: H00004598-A01
Product name: MVK polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant MVK.
Gene id: 4598
Gene name: MVK
Gene alias: FLJ96772|LRBP|MK|MVLK
Gene description: mevalonate kinase
Genbank accession: BC016140
Immunogen: MVK (AAH16140, 297 a.a. ~ 396 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: LIDMNQHHLNALGVGHASLDQLCQVTRARGLHSKLTGAGGGGCGITLLKPGLEQPEVEATKQALTSCGFDCLETSIGAPGVSIHSATSLDSRVQQALDGL
Protein accession: AAH16140
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004598-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.11 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00004598-A01-1-4-1.jpg
Application image note: MVK polyclonal antibody (A01), Lot # 051116JC01 Western Blot analysis of MVK expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MVK polyclonal antibody (A01) now

Add to cart