Brand: | Abnova |
Reference: | H00004597-M01 |
Product name: | MVD monoclonal antibody (M01), clone 2A7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MVD. |
Clone: | 2A7 |
Isotype: | IgG2a Kappa |
Gene id: | 4597 |
Gene name: | MVD |
Gene alias: | FP17780|MPD |
Gene description: | mevalonate (diphospho) decarboxylase |
Genbank accession: | NM_002461 |
Immunogen: | MVD (NP_002452, 301 a.a. ~ 398 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AYTFDAGPNAVIFTLDDTVAEFVAAVWHGFPPGSNGDTFLKGLQVRPAPLSAELQAALAMEPTPGGVKYIIVTQVGPGPQILDDPCAHLLGPDGLPKP |
Protein accession: | NP_002452 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | MVD monoclonal antibody (M01), clone 2A7 Western Blot analysis of MVD expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |