MUSK monoclonal antibody (M08), clone 4C4 View larger

MUSK monoclonal antibody (M08), clone 4C4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MUSK monoclonal antibody (M08), clone 4C4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about MUSK monoclonal antibody (M08), clone 4C4

Brand: Abnova
Reference: H00004593-M08
Product name: MUSK monoclonal antibody (M08), clone 4C4
Product description: Mouse monoclonal antibody raised against a partial recombinant MUSK.
Clone: 4C4
Isotype: IgG2b Kappa
Gene id: 4593
Gene name: MUSK
Gene alias: MGC126323|MGC126324
Gene description: muscle, skeletal, receptor tyrosine kinase
Genbank accession: NM_005592
Immunogen: MUSK (NP_005583, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ISIAEWSKPQKDNKGYCAQYRGEVCNAVLAKDALVFLNTSYADPEEAQELLVHTAWNELKVVSPVCRPAAEALLCNHIFQECSPGVVPTPIPICREYCLA
Protein accession: NP_005583
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004593-M08-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004593-M08-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged MUSK is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MUSK monoclonal antibody (M08), clone 4C4 now

Add to cart