Brand: | Abnova |
Reference: | H00004589-M06A |
Product name: | MUC7 monoclonal antibody (M06A), clone 7F2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MUC7. |
Clone: | 7F2 |
Isotype: | IgG2a Kappa |
Gene id: | 4589 |
Gene name: | MUC7 |
Gene alias: | DKFZp686J03256|FLJ27047|MG2|MGC34772 |
Gene description: | mucin 7, secreted |
Genbank accession: | NM_152291 |
Immunogen: | MUC7 (NP_689504, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | HQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQN |
Protein accession: | NP_689504 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |