MUC7 monoclonal antibody (M06A), clone 7F2 View larger

MUC7 monoclonal antibody (M06A), clone 7F2

H00004589-M06A_200uL

New product

395,00 € tax excl.

200 UL

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MUC7 monoclonal antibody (M06A), clone 7F2

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about MUC7 monoclonal antibody (M06A), clone 7F2

Brand: Abnova
Reference: H00004589-M06A
Product name: MUC7 monoclonal antibody (M06A), clone 7F2
Product description: Mouse monoclonal antibody raised against a partial recombinant MUC7.
Clone: 7F2
Isotype: IgG2a Kappa
Gene id: 4589
Gene name: MUC7
Gene alias: DKFZp686J03256|FLJ27047|MG2|MGC34772
Gene description: mucin 7, secreted
Genbank accession: NM_152291
Immunogen: MUC7 (NP_689504, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: HQSPKSHFELPHYPGLLAHQKPFIRKSYKCLHKRCRPKLPPSPNNPPKFPNPHQPPKHPDKNSSVVNPTLVATTQIPSVTFPSASTKITTLPNVTFLPQN
Protein accession: NP_689504
Storage buffer: In ascites fluid
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004589-M06A-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MUC7 monoclonal antibody (M06A), clone 7F2 now

Add to cart