Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MUC5AC monoclonal antibody (M07), clone 2H7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about MUC5AC monoclonal antibody (M07), clone 2H7
| Brand: | Abnova |
| Reference: | H00004586-M07 |
| Product name: | MUC5AC monoclonal antibody (M07), clone 2H7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MUC5AC. |
| Clone: | 2H7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 4586 |
| Gene name: | MUC5AC |
| Gene alias: | MUC5 |
| Gene description: | mucin 5AC, oligomeric mucus/gel-forming |
| Genbank accession: | XM_495860 |
| Immunogen: | MUC5AC (XP_495860, 351 a.a. ~ 450 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NQSTCAVYHRSLIIQQQGCSSSEPVRLAYCRGNCGDSSSMYSLEGNTVEHRCQCCQELRTSLRNVTLHCTDGSSRAFSYTEVEECGCMGRRCPAPGDTQH |
| Protein accession: | XP_495860 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MUC5AC is approximately 3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Effect of a Semi-Purified Oligosaccharide-Enriched Fraction from Caprine Milk on Barrier Integrity and Mucin Production of Co-Culture Models of the Small and Large Intestinal Epithelium.Barnett AM, Roy NC, McNabb WC, Cookson AL. Nutrients. 2016 May 6. [Epub ahead of print] |