Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MUC2 monoclonal antibody (M04), clone 3D10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about MUC2 monoclonal antibody (M04), clone 3D10
| Brand: | Abnova |
| Reference: | H00004583-M04 |
| Product name: | MUC2 monoclonal antibody (M04), clone 3D10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MUC2. |
| Clone: | 3D10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 4583 |
| Gene name: | MUC2 |
| Gene alias: | MLP|SMUC |
| Gene description: | mucin 2, oligomeric mucus/gel-forming |
| Genbank accession: | NM_002457 |
| Immunogen: | MUC2 (NP_002448, 5081 a.a. ~ 5179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TTEVSYAGCTKTVLMNHCSGSCGTFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESCQCQDTVCGLPTGTSRRARRSPRHLGSG* |
| Protein accession: | NP_002448 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |