MUC2 monoclonal antibody (M02), clone 1D10 View larger

MUC2 monoclonal antibody (M02), clone 1D10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MUC2 monoclonal antibody (M02), clone 1D10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about MUC2 monoclonal antibody (M02), clone 1D10

Brand: Abnova
Reference: H00004583-M02
Product name: MUC2 monoclonal antibody (M02), clone 1D10
Product description: Mouse monoclonal antibody raised against a partial recombinant MUC2.
Clone: 1D10
Isotype: IgG2a Kappa
Gene id: 4583
Gene name: MUC2
Gene alias: MLP|SMUC
Gene description: mucin 2, oligomeric mucus/gel-forming
Genbank accession: NM_002457
Immunogen: MUC2 (NP_002448, 5081 a.a. ~ 5179 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TTEVSYAGCTKTVLMNHCSGSCGTFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESCQCQDTVCGLPTGTSRRARRSPRHLGSG*
Protein accession: NP_002448
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy MUC2 monoclonal antibody (M02), clone 1D10 now

Add to cart