Brand: | Abnova |
Reference: | H00004582-Q01 |
Product name: | MUC1 (Human) Recombinant Protein (Q01) |
Product description: | Human MUC1 partial ORF ( NP_877418.1, 315 a.a. - 420 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 4582 |
Gene name: | MUC1 |
Gene alias: | CD227|EMA|H23AG|MAM6|PEM|PEMT|PUM |
Gene description: | mucin 1, cell surface associated |
Genbank accession: | NM_182741.1 |
Immunogen sequence/protein sequence: | NSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDMETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWG |
Protein accession: | NP_877418.1 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: |  |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Identification of tumor-reactive B cells and systemic IgG in breast cancer based on clonal frequency in the sentinel lymph node.McDaniel JR, Pero SC, Voss WN, Shukla GS, Sun Y, Schaetzle S, Lee CH, Horton AP, Harlow S, Gollihar J, Ellefson JW, Krag CC, Tanno Y, Sidiropoulos N, Georgiou G, Ippolito GC, Krag DN. Cancer Immunol Immunother. 2018 May;67(5):729-738. doi: 10.1007/s00262-018-2123-2. Epub 2018 Feb 9. |