Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MUC1 monoclonal antibody (M01), clone 3B9
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
More info about MUC1 monoclonal antibody (M01), clone 3B9
| Brand: | Abnova |
| Reference: | H00004582-M01 |
| Product name: | MUC1 monoclonal antibody (M01), clone 3B9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MUC1. |
| Clone: | 3B9 |
| Isotype: | IgG2b Kappa |
| Gene id: | 4582 |
| Gene name: | MUC1 |
| Gene alias: | CD227|EMA|H23AG|MAM6|PEM|PEMT|PUM |
| Gene description: | mucin 1, cell surface associated |
| Genbank accession: | NM_182741.1 |
| Immunogen: | MUC1 (NP_877418.1, 315 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGTINVHDMETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWG |
| Protein accession: | NP_877418.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.4 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MUC1 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Identification of a New Panel of Serum Autoantibodies Associated with the Presence of In situ Carcinoma of the Breast in Younger Women.Desmetz C, Bascoul-Mollevi C, Rochaix P, Lamy PJ, Kramar A, Rouanet P, Maudelonde T, Mange A, Solassol J. Clin Cancer Res. 2009 Jul 15;15(14):4733-41. Epub 2009 Jul 7. |