ND4 polyclonal antibody (A01) View larger

ND4 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ND4 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about ND4 polyclonal antibody (A01)

Brand: Abnova
Reference: H00004538-A01
Product name: ND4 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant ND4.
Gene id: 4538
Gene name: ND4
Gene alias: MTND4
Gene description: NADH dehydrogenase, subunit 4 (complex I)
Genbank accession: NC_012920.1
Immunogen: ND4 (YP_003024035.1, 406 a.a. ~ 459 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: YSLYIFTTTQWGSLTHHINNIKPSFTRENTLMFIHLSPILLLSLNPDIITGFSS
Protein accession: YP_003024035.1
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004538-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.05 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ND4 polyclonal antibody (A01) now

Add to cart