ND1 monoclonal antibody (M01), clone 3H3 View larger

ND1 monoclonal antibody (M01), clone 3H3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ND1 monoclonal antibody (M01), clone 3H3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about ND1 monoclonal antibody (M01), clone 3H3

Brand: Abnova
Reference: H00004535-M01
Product name: ND1 monoclonal antibody (M01), clone 3H3
Product description: Mouse monoclonal antibody raised against a partial recombinant ND1.
Clone: 3H3
Isotype: IgG2a Kappa
Gene id: 4535
Gene name: ND1
Gene alias: MTND1
Gene description: NADH dehydrogenase, subunit 1 (complex I)
Genbank accession: NC_012920.1
Immunogen: ND1 (YP_003024026, 21 a.a. ~ 71 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MLTERKILGYIQLRKGPNVVGPYGLLQPFADAIKLFTKEPLKPATSTITLY
Protein accession: YP_003024026
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004535-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (31.35 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004535-M01-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged ND1 is 0.03 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy ND1 monoclonal antibody (M01), clone 3H3 now

Add to cart