Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MTF1 monoclonal antibody (M07A), clone 4A5
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about MTF1 monoclonal antibody (M07A), clone 4A5
| Brand: | Abnova |
| Reference: | H00004520-M07A |
| Product name: | MTF1 monoclonal antibody (M07A), clone 4A5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MTF1. |
| Clone: | 4A5 |
| Isotype: | IgM Kappa |
| Gene id: | 4520 |
| Gene name: | MTF1 |
| Gene alias: | MGC23036|MTF-1|ZRF |
| Gene description: | metal-regulatory transcription factor 1 |
| Genbank accession: | NM_005955 |
| Immunogen: | MTF1 (NP_005946, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GTVYDRTTVLIEQDPGTLEDEDDDGQCGEHLPFLVGGEEGFHLIDHEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEGATLTLQSECPETKRKEVKRY |
| Protein accession: | NP_005946 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |