Brand: | Abnova |
Reference: | H00004520-M07A |
Product name: | MTF1 monoclonal antibody (M07A), clone 4A5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MTF1. |
Clone: | 4A5 |
Isotype: | IgM Kappa |
Gene id: | 4520 |
Gene name: | MTF1 |
Gene alias: | MGC23036|MTF-1|ZRF |
Gene description: | metal-regulatory transcription factor 1 |
Genbank accession: | NM_005955 |
Immunogen: | MTF1 (NP_005946, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GTVYDRTTVLIEQDPGTLEDEDDDGQCGEHLPFLVGGEEGFHLIDHEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEGATLTLQSECPETKRKEVKRY |
Protein accession: | NP_005946 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |