MTF1 monoclonal antibody (M06), clone 3G12 View larger

MTF1 monoclonal antibody (M06), clone 3G12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MTF1 monoclonal antibody (M06), clone 3G12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about MTF1 monoclonal antibody (M06), clone 3G12

Brand: Abnova
Reference: H00004520-M06
Product name: MTF1 monoclonal antibody (M06), clone 3G12
Product description: Mouse monoclonal antibody raised against a partial recombinant MTF1.
Clone: 3G12
Isotype: IgG2a Kappa
Gene id: 4520
Gene name: MTF1
Gene alias: MGC23036|MTF-1|ZRF
Gene description: metal-regulatory transcription factor 1
Genbank accession: NM_005955
Immunogen: MTF1 (NP_005946, 41 a.a. ~ 140 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GTVYDRTTVLIEQDPGTLEDEDDDGQCGEHLPFLVGGEEGFHLIDHEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEGATLTLQSECPETKRKEVKRY
Protein accession: NP_005946
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004520-M06-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00004520-M06-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged MTF1 is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MTF1 monoclonal antibody (M06), clone 3G12 now

Add to cart