MTAP monoclonal antibody (M01), clone 2G4 View larger

MTAP monoclonal antibody (M01), clone 2G4

H00004507-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MTAP monoclonal antibody (M01), clone 2G4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,IF,S-ELISA,ELISA,WB-Re

More info about MTAP monoclonal antibody (M01), clone 2G4

Brand: Abnova
Reference: H00004507-M01
Product name: MTAP monoclonal antibody (M01), clone 2G4
Product description: Mouse monoclonal antibody raised against a full length recombinant MTAP.
Clone: 2G4
Isotype: IgG1 Kappa
Gene id: 4507
Gene name: MTAP
Gene alias: MSAP|c86fus
Gene description: methylthioadenosine phosphorylase
Genbank accession: BC018625
Immunogen: MTAP (AAH18625, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS
Protein accession: AAH18625
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00004507-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (42.68 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00004507-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to MTAP on HeLa cell. [antibody concentration 10 ug/ml]
Applications: WB-Ce,IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Integrative genomics identifies molecular alterations that challenge the linear model of melanoma progression.Rose AE, Poliseno L, Wang J, Clark M, Pearlman A, Wang G, Vega Y Saenz de Miera EC, Medicherla R, Christos PJ, Shapiro RL, Pavlick AC, Darvishian F, Zavadil J, Polsky D, Hernando E, Ostrer H, Osman I.
Cancer Res. 2011 Feb 22. [Epub ahead of print]

Reviews

Buy MTAP monoclonal antibody (M01), clone 2G4 now

Add to cart