Brand: | Abnova |
Reference: | H00004507-M01 |
Product name: | MTAP monoclonal antibody (M01), clone 2G4 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant MTAP. |
Clone: | 2G4 |
Isotype: | IgG1 Kappa |
Gene id: | 4507 |
Gene name: | MTAP |
Gene alias: | MSAP|c86fus |
Gene description: | methylthioadenosine phosphorylase |
Genbank accession: | BC018625 |
Immunogen: | MTAP (AAH18625, 1 a.a. ~ 154 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS |
Protein accession: | AAH18625 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00004507-M01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00004507-M01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (42.68 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![H00004507-M01-4-1-1-L.jpg](http://www.abnova.com/application_image/H00004507-M01-4-1-1-L.jpg) |
Application image note: | Immunofluorescence of monoclonal antibody to MTAP on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Integrative genomics identifies molecular alterations that challenge the linear model of melanoma progression.Rose AE, Poliseno L, Wang J, Clark M, Pearlman A, Wang G, Vega Y Saenz de Miera EC, Medicherla R, Christos PJ, Shapiro RL, Pavlick AC, Darvishian F, Zavadil J, Polsky D, Hernando E, Ostrer H, Osman I. Cancer Res. 2011 Feb 22. [Epub ahead of print] |