Brand: | Abnova |
Reference: | H00004504-M02 |
Product name: | MT3 monoclonal antibody (M02), clone 1F11 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant MT3. |
Clone: | 1F11 |
Isotype: | IgG2b Kappa |
Gene id: | 4504 |
Gene name: | MT3 |
Gene alias: | GIF|GIFB|GRIF |
Gene description: | metallothionein 3 |
Genbank accession: | BC013081.1 |
Immunogen: | MT3 (AAH13081, 1 a.a. ~ 68 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ |
Protein accession: | AAH13081 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00004504-M02-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00004504-M02-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (33.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |