Brand: | Abnova |
Reference: | H00004504-M01A |
Product name: | MT3 monoclonal antibody (M01A), clone 3E8 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant MT3. |
Clone: | 3E8 |
Isotype: | IgM Kappa |
Gene id: | 4504 |
Gene name: | MT3 |
Gene alias: | GIF|GIFB|GRIF |
Gene description: | metallothionein 3 |
Genbank accession: | BC013081.1 |
Immunogen: | MT3 (AAH13081, 1 a.a. ~ 68 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MDPETCPCPSGGSCTCADSCKCEGCKCTSCKKSCCSCCPAECEKCAKDCVCKGGEAAEAEAEKCSCCQ |
Protein accession: | AAH13081 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | |
Quality control testing picture note: | Western Blot detection against Immunogen (33.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Human metallothioneins 2 and 3 differentially affect amyloid-beta binding by transthyretin.Martinho A, Goncalves I, Cardoso I, Almeida MR, Quintela T, Saraiva MJ, Santos CR. FEBS J. 2010 Aug;277(16):3427-36. Epub 2010 Jul 14. |