Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of MT2A monoclonal antibody (M01), clone 6G2
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about MT2A monoclonal antibody (M01), clone 6G2
| Brand: | Abnova |
| Reference: | H00004502-M01 |
| Product name: | MT2A monoclonal antibody (M01), clone 6G2 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant MT2A. |
| Clone: | 6G2 |
| Isotype: | IgG2a Lambda |
| Gene id: | 4502 |
| Gene name: | MT2A |
| Gene alias: | MT2 |
| Gene description: | metallothionein 2A |
| Genbank accession: | NM_005953.2 |
| Immunogen: | MT2A (NP_005944.1, 1 a.a. ~ 61 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSCCA |
| Protein accession: | NP_005944.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (32.4 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged MT2A is 0.3 ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Macrophages in T cell/histiocyte rich large B cell lymphoma strongly express metal-binding proteins and show a bi-activated phenotype.Hartmann S, Tousseyn T, Doring C, Fluchter P, Hackstein H, Herreman A, Ponzoni M, de Wolf-Peeters C, Facchetti F, Gascoyne RD, Kuppers R, Steidl C, Hansmann ML Int J Cancer. 2013 Dec 1;133(11):2609-18. doi: 10.1002/ijc.28273. Epub 2013 Jun 29. |