Brand: | Abnova |
Reference: | H00004488-M04 |
Product name: | MSX2 monoclonal antibody (M04), clone 1F6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MSX2. |
Clone: | 1F6 |
Isotype: | IgG2a Kappa |
Gene id: | 4488 |
Gene name: | MSX2 |
Gene alias: | CRS2|FPP|HOX8|MSH|PFM|PFM1 |
Gene description: | msh homeobox 2 |
Genbank accession: | NM_002449 |
Immunogen: | MSX2 (NP_002440, 101 a.a. ~ 201 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | TASVKSENSEDGAAWMQEPGRYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLNLTETQVKIWFQNRRAKAKRL* |
Protein accession: | NP_002440 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to MSX2 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1.5 ug/ml] |
Applications: | IHC-P,IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Establishment of human dental epithelial cell lines expressing ameloblastin and enamelin by transfection of hTERT and cdk4 cDNAs.Hatakeyama S, Mizusawa N, Tsutsumi R, Yoshimoto K, Mizuki H, Yasumoto S, Sato S, Takeda Y. J Oral Pathol Med. 2010 Oct 4. doi: 10.1111/j.1600-0714.2010.00950.x. [Epub ahead of print] |