MSX1 (Human) Recombinant Protein (Q01) View larger

MSX1 (Human) Recombinant Protein (Q01)

New product

374,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MSX1 (Human) Recombinant Protein (Q01)

BrandAbnova
Product typeProteins
ApplicationsAP,Array,ELISA,WB-Re

More info about MSX1 (Human) Recombinant Protein (Q01)

Brand: Abnova
Reference: H00004487-Q01
Product name: MSX1 (Human) Recombinant Protein (Q01)
Product description: Human MSX1 partial ORF (NP_002439.1, 216 a.a. - 297 a.a.) recombinant protein with GST tag at N-terminal.
Gene id: 4487
Gene name: MSX1
Gene alias: HOX7|HYD1
Gene description: msh homeobox 1
Genbank accession: NM_002448.1
Immunogen sequence/protein sequence: NRRAKAKRLQEAELEKLKMAAKPMLPPAAFGLSFPLGGPAAVAAAAGASLYGASGPFQRAALPVAPVGLYTAHVGYSMYHLT
Protein accession: NP_002439.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue
Quality control testing picture: qc_test-H00004487-Q01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy MSX1 (Human) Recombinant Protein (Q01) now

Add to cart